Lineage for d1s5hc_ (1s5h C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023620Protein Potassium channel protein [56901] (3 species)
  7. 3023623Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 3023626Domain d1s5hc_: 1s5h C: [105271]
    Other proteins in same PDB: d1s5ha1, d1s5ha2, d1s5hb1, d1s5hb2, d1s5hb3
    complexed with dga, f09, k; mutant

Details for d1s5hc_

PDB Entry: 1s5h (more details), 2.2 Å

PDB Description: potassium channel kcsa-fab complex t75c mutant in k+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1s5hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5hc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatcvgygdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d1s5hc_:

Click to download the PDB-style file with coordinates for d1s5hc_.
(The format of our PDB-style files is described here.)

Timeline for d1s5hc_: