Lineage for d1s5hb2 (1s5h B:119-219)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453517Domain d1s5hb2: 1s5h B:119-219 [105270]
    Other proteins in same PDB: d1s5ha1, d1s5ha2, d1s5hb1, d1s5hc_

Details for d1s5hb2

PDB Entry: 1s5h (more details), 2.2 Å

PDB Description: potassium channel kcsa-fab complex t75c mutant in k+

SCOP Domain Sequences for d1s5hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5hb2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1s5hb2:

Click to download the PDB-style file with coordinates for d1s5hb2.
(The format of our PDB-style files is described here.)

Timeline for d1s5hb2: