SCOP 1.75: Domain d1s5ha1: 1s5h A:1-107

Lineage for d1s5ha1 (1s5h A:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (182 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7
   SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
   SQ NA # humanized antibody
   SQ NA # part of Fab 28 against HIV-1 RT
   Uniprot P01642 21-115 #
   KV5I_MOUSE Ig kappa chain V-V region L7 precursor
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d1s5ha1: 1s5h A:1-107 [105267]
   Other proteins in same PDB: d1s5ha2, d1s5hb1, d1s5hb2, d1s5hc_
   complexed with dga, f09, k; mutant

Details for d1s5ha1

PDB Entry: 1s5h, 2.2 Å

PDB Description: potassium channel kcsa-fab complex t75c mutant in k+

PDB Compounds: (A:) antibody fab fragment light chain

SCOP Domain Sequences for d1s5ha1:

Sequence; same for both SEQRES and ATOM records:

>d1s5ha1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

Timeline for d1s5ha1:

• d1s5ha1 first appeared in SCOP 1.69
  
• d1s5ha1 appears in SCOP 1.73
  
• d1s5ha1 appears in SCOPe 2.01
  
• d1s5ha1 appears in the current release, SCOPe 2.08