SCOPe 2.06: Domain d1s5gy_: 1s5g Y:

Lineage for d1s5gy_ (1s5g Y:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Essential Chain [47524] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
   Uniprot P13543

8. Domain d1s5gy_: 1s5g Y: [105265]
   Other proteins in same PDB: d1s5ga1, d1s5ga2, d1s5gz_
   complexed with adp, ca, mg, so4

Details for d1s5gy_

PDB Entry: 1s5g, 3.1 Å

PDB Description: Structure of Scallop myosin S1 reveals a novel nucleotide conformation

PDB Compounds: (Y:) myosin regulatory light chain, striated adductor muscle

SCOPe Domain Sequences for d1s5gy_:

Sequence; same for both SEQRES and ATOM records:

>d1s5gy_ a.39.1.5 (Y:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
pveggkfdyvkftamikgsgee

Timeline for d1s5gy_:

• d1s5gy_ first appeared in SCOP 1.69
  
• d1s5gy_ appears in SCOPe 2.05
  
• d1s5gy_ appears in SCOPe 2.07
  
• d1s5gy_ appears in the current release, SCOPe 2.08