![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.4: Parvalbumin [47492] (2 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
![]() | Protein Parvalbumin [47495] (7 species) |
![]() | Species Rat (Rattus rattus) [TaxId:10117] [47501] (4 PDB entries) |
![]() | Domain d1s3pa_: 1s3p A: [105249] complexed with ca, so4; mutant |
PDB Entry: 1s3p (more details), 2 Å
SCOP Domain Sequences for d1s3pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3pa_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus)} smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdkdgfide delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes
Timeline for d1s3pa_: