Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1s3kl2: 1s3k L:113-216 [105240] Other proteins in same PDB: d1s3kh1, d1s3kh2, d1s3kl1 MQ NA # artificial chimera complexed with fuc, gal, gol, nag |
PDB Entry: 1s3k (more details), 1.9 Å
SCOP Domain Sequences for d1s3kl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s3kl2 b.1.1.2 (L:113-216) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d1s3kl2: