SCOP 1.71: Domain d1s3kh1: 1s3k H:1-119

Lineage for d1s3kh1 (1s3k H:1-119)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1s3kh1: 1s3k H:1-119 [105237]
   Other proteins in same PDB: d1s3kh2, d1s3kl2
   MQ NA P01857 # artificial chimera
   complexed with fuc, gal, gol, nag

Details for d1s3kh1

PDB Entry: 1s3k, 1.9 Å

PDB Description: crystal structure of a humanized fab (hu3s193) in complex with the lewis y tetrasaccharide

SCOP Domain Sequences for d1s3kh1:

Sequence; same for both SEQRES and ATOM records:

>d1s3kh1 b.1.1.1 (H:1-119) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvss

Timeline for d1s3kh1:

• d1s3kh1 first appeared in SCOP 1.69
  
• d1s3kh1 appears in SCOP 1.73
  
• d1s3kh1 appears in the current release, SCOPe 2.08