Lineage for d1s3kh1 (1s3k H:1-119)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451613Species Engineered (including hybrid species) [88533] (31 PDB entries)
  8. 451661Domain d1s3kh1: 1s3k H:1-119 [105237]
    Other proteins in same PDB: d1s3kh2, d1s3kl2

Details for d1s3kh1

PDB Entry: 1s3k (more details), 1.9 Å

PDB Description: crystal structure of a humanized fab (hu3s193) in complex with the lewis y tetrasaccharide

SCOP Domain Sequences for d1s3kh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3kh1 b.1.1.1 (H:1-119) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvss

SCOP Domain Coordinates for d1s3kh1:

Click to download the PDB-style file with coordinates for d1s3kh1.
(The format of our PDB-style files is described here.)

Timeline for d1s3kh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s3kh2