Lineage for d1s3ha2 (1s3h A:4-306)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098241Family c.1.10.5: HMGL-like [89494] (3 proteins)
    Pfam PF00682
  6. 2098252Protein Transcarboxylase 5S subunit, N-terminal domain [110366] (1 species)
  7. 2098253Species Propionibacterium freudenreichii shermanii [TaxId:1752] [110367] (6 PDB entries)
    Uniprot Q70AC7 3-474
  8. 2098258Domain d1s3ha2: 1s3h A:4-306 [105236]
    Other proteins in same PDB: d1s3ha1
    complexed with co

Details for d1s3ha2

PDB Entry: 1s3h (more details), 2.5 Å

PDB Description: propionibacterium shermanii transcarboxylase 5s subunit a59t
PDB Compounds: (A:) transcarboxylase 5S subunit

SCOPe Domain Sequences for d1s3ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ha2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}
reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggttyds
cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
kdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
ksq

SCOPe Domain Coordinates for d1s3ha2:

Click to download the PDB-style file with coordinates for d1s3ha2.
(The format of our PDB-style files is described here.)

Timeline for d1s3ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s3ha1