![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries) Uniprot P24931 |
![]() | Domain d1s30a1: 1s30 A:2-147 [105232] Other proteins in same PDB: d1s30a2 complexed with fe, zn |
PDB Entry: 1s30 (more details), 2.05 Å
SCOPe Domain Sequences for d1s30a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s30a1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf asiavaeefhekrfldfarnikegrv
Timeline for d1s30a1: