SCOP 1.69: Domain d1s30a1: 1s30 A:2-147

Lineage for d1s30a1 (1s30 A:2-147)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)

8. Domain d1s30a1: 1s30 A:2-147 [105232]
   Other proteins in same PDB: d1s30a2

Details for d1s30a1

PDB Entry: 1s30, 2.05 Å

PDB Description: X-ray crystal structure of Desulfovibrio vulgaris Rubrerythrin with displacement of iron by zinc at the diiron Site

SCOP Domain Sequences for d1s30a1:

Sequence; same for both SEQRES and ATOM records:

>d1s30a1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris}
kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
asiavaeefhekrfldfarnikegrv

Timeline for d1s30a1:

• d1s30a1 is new in SCOP 1.69
  
• d1s30a1 appears in SCOP 1.71
  
• d1s30a1 appears in the current release, SCOPe 2.08