Lineage for d1s2za2 (1s2z A:148-191)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966025Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1966026Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1966128Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 1966129Species Desulfovibrio vulgaris [TaxId:881] [57812] (10 PDB entries)
    Uniprot P24931
  8. 1966133Domain d1s2za2: 1s2z A:148-191 [105231]
    Other proteins in same PDB: d1s2za1
    complexed with fe, zn

Details for d1s2za2

PDB Entry: 1s2z (more details), 1.75 Å

PDB Description: X-ray crystal structure of Desulfovibrio vulgaris Rubrerythrin with displacement of iron by zinc at the diiron Site
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1s2za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2za2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
flreqatkwrcrncgyvhegtgapelcpacahpkahfellginw

SCOPe Domain Coordinates for d1s2za2:

Click to download the PDB-style file with coordinates for d1s2za2.
(The format of our PDB-style files is described here.)

Timeline for d1s2za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s2za1