Lineage for d1s1is_ (1s1i S:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1248422Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries)
  8. 1248459Domain d1s1is_: 1s1i S: [105193]
    MQ NA # low resolution complex structure
    60S subunit; the 40S subunit is in 1S1H
    protein/RNA complex

Details for d1s1is_

PDB Entry: 1s1i (more details), 11.7 Å

PDB Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1I, Contains 60S subunit. The 40S Ribosomal Subunit Is In File 1S1H.
PDB Compounds: (S:) 60S ribosomal protein L24-A

SCOPe Domain Sequences for d1s1is_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1is_ i.1.1.1 (S:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eidsfsgakiypgrgtlfvrgdskifrfqnsksaslfkqrknprriawtvlfr

SCOPe Domain Coordinates for d1s1is_:

Click to download the PDB-style file with coordinates for d1s1is_.
(The format of our PDB-style files is described here.)

Timeline for d1s1is_: