Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111483] (2 PDB entries) |
Domain d1s1hk_: 1s1h K: [105163] MQ NA # low resolution complex structure 40S subunit; the 60S subunit is in 1S1I |
PDB Entry: 1s1h (more details), 11.7 Å
SCOP Domain Sequences for d1s1hk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s1hk_ i.1.1.1 (K:) 70S ribosome functional complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dnsqvfgvariyasfndtfvhvtdlsgketiarvtggmkvkadrdesspyaamlaaqdva akcrevgitavhvkiratggtrtktpgpggqaalralarsglrigriedvtpvpsdstrk kggrr
Timeline for d1s1hk_: