SCOP 1.73: Domain d1s0ja1: 1s0j A:409-632

Lineage for d1s0ja1 (1s0j A:409-632)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)

6. Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)

7. Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89271] (11 PDB entries)

8. Domain d1s0ja1: 1s0j A:409-632 [105148]
   Other proteins in same PDB: d1s0ja2
   complexed with mus; mutant

Details for d1s0ja1

PDB Entry: 1s0j, 1.65 Å

PDB Description: trypanosoma cruzi trans-sialidase in complex with munana (michaelis complex)

PDB Compounds: (A:) Trans-sialidase

SCOP Domain Sequences for d1s0ja1:

Sequence; same for both SEQRES and ATOM records:

>d1s0ja1 b.29.1.15 (A:409-632) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah

Timeline for d1s0ja1:

• d1s0ja1 first appeared in SCOP 1.69
  
• d1s0ja1 appears in SCOP 1.71
  
• d1s0ja1 appears in SCOP 1.75
  
• d1s0ja1 appears in the current release, SCOPe 2.08