Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein) |
Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species) |
Species Trypanosoma cruzi [TaxId:5693] [89271] (13 PDB entries) Uniprot Q26966 |
Domain d1s0ja1: 1s0j A:409-632 [105148] Other proteins in same PDB: d1s0ja2 complexed with mus |
PDB Entry: 1s0j (more details), 1.65 Å
SCOPe Domain Sequences for d1s0ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ja1 b.29.1.15 (A:409-632) Trypanosoma sialidase, C-terminal domain {Trypanosoma cruzi [TaxId: 5693]} gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah
Timeline for d1s0ja1: