Lineage for d1s03g_ (1s03 G:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611465Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 611466Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 611467Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 611468Protein Ribosomal protein S8 [56049] (4 species)
  7. 611475Species Escherichia coli [TaxId:562] [111186] (1 PDB entry)
  8. 611476Domain d1s03g_: 1s03 G: [105144]

Details for d1s03g_

PDB Entry: 1s03 (more details), 2.7 Å

PDB Description: The Structure of a Ribosomal Protein S8/spc Operon mRNA Complex

SCOP Domain Sequences for d1s03g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s03g_ d.140.1.1 (G:) Ribosomal protein S8 {Escherichia coli}
dpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltlk
yfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgge
iicyva

SCOP Domain Coordinates for d1s03g_:

Click to download the PDB-style file with coordinates for d1s03g_.
(The format of our PDB-style files is described here.)

Timeline for d1s03g_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s03h_