SCOP 1.69: Domain d1s03g_: 1s03 G:

Lineage for d1s03g_ (1s03 G:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
   consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (4 species)

7. Species Escherichia coli [TaxId:562] [111186] (1 PDB entry)

8. Domain d1s03g_: 1s03 G: [105144]

Details for d1s03g_

PDB Entry: 1s03, 2.7 Å

PDB Description: The Structure of a Ribosomal Protein S8/spc Operon mRNA Complex

SCOP Domain Sequences for d1s03g_:

Sequence; same for both SEQRES and ATOM records:

>d1s03g_ d.140.1.1 (G:) Ribosomal protein S8 {Escherichia coli}
dpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltlk
yfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgge
iicyva

Timeline for d1s03g_:

• d1s03g_ is new in SCOP 1.69
  
• d1s03g_ appears in SCOP 1.71
  
• d1s03g_ appears in the current release, SCOPe 2.08