SCOPe 2.07: Domain d1rteb_: 1rte B:

Lineage for d1rteb_ (1rte B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
   lack the first helix (A)

6. Protein Protozoan/bacterial hemoglobin [46460] (6 species)

7. Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
   Uniprot Q10784

8. Domain d1rteb_: 1rte B: [105097]
   complexed with cyn, hem, so4

Details for d1rteb_

PDB Entry: 1rte, 2 Å

PDB Description: X-ray Structure of Cyanide Derivative of Truncated Hemoglobin N (trHbN) from Mycobacterium Tuberculosis

PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d1rteb_:

Sequence; same for both SEQRES and ATOM records:

>d1rteb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvtsg

Timeline for d1rteb_:

• d1rteb_ first appeared in SCOP 1.69
  
• d1rteb_ appears in SCOPe 2.06
  
• d1rteb_ appears in the current release, SCOPe 2.08