Lineage for d1rqha1 (1rqh A:307-474)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439425Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 439528Superfamily a.5.7: post-HMGL domain-like [89000] (2 families) (S)
  5. 439540Family a.5.7.2: Conserved carboxylase domain (Pfam 02436) [109725] (1 protein)
    duplication: contains two domains of this fold, connected with a helical linker
  6. 439541Protein Transcarboxylase 5S subunit, C-terminal domain [109726] (1 species)
  7. 439542Species Propionibacterium freudenreichii shermanii [TaxId:1752] [109727] (6 PDB entries)
    d1: 307-367; d2: 416-459
  8. 439544Domain d1rqha1: 1rqh A:307-474 [105066]
    Other proteins in same PDB: d1rqha2

Details for d1rqha1

PDB Entry: 1rqh (more details), 2 Å

PDB Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to pyruvic acid
PDB Compounds: (A:)

SCOP Domain Sequences for d1rqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqha1 a.5.7.2 (A:307-474) Transcarboxylase 5S subunit, C-terminal domain {Propionibacterium freudenreichii shermanii}
ipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnvmmg
eykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqskea
atlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea

SCOP Domain Coordinates for d1rqha1:

Click to download the PDB-style file with coordinates for d1rqha1.
(The format of our PDB-style files is described here.)

Timeline for d1rqha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqha2