Lineage for d1rqga1 (1rqg A:397-606)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441880Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 441881Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 441882Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 441910Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 441921Species Pyrococcus abyssi [TaxId:29292] [109792] (1 PDB entry)
  8. 441922Domain d1rqga1: 1rqg A:397-606 [105063]
    Other proteins in same PDB: d1rqga2, d1rqga3

Details for d1rqga1

PDB Entry: 1rqg (more details), 2.9 Å

PDB Description: Methionyl-tRNA synthetase from Pyrococcus abyssi

SCOP Domain Sequences for d1rqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqga1 a.27.1.1 (A:397-606) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi}
vnnlgnfvhraltfvnryfdgvvpergeldeldrealeeiekafkevgelimnyrfkdal
krvmslasfgnryfdhkqpwktakedkvrtgttvnislqivkalgillepflpdasekiw
hllnldevkrwefrelpaghkvrkpeilfkkvtddqiiyfilnymakgnpegarilldky
ykredvirvakekfgdeaevvlrrvykdik

SCOP Domain Coordinates for d1rqga1:

Click to download the PDB-style file with coordinates for d1rqga1.
(The format of our PDB-style files is described here.)

Timeline for d1rqga1: