SCOPe 2.06: Domain d1rpqd1: 1rpq D:4-85

Lineage for d1rpqd1 (1rpq D:4-85)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein IgE high affinity receptor alpha subunit [49200] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49201] (7 PDB entries)
   Uniprot P12319 29-196

8. Domain d1rpqd1: 1rpq D:4-85 [105034]
   complexed with cit, ndg, so4

Details for d1rpqd1

PDB Entry: 1rpq, 3 Å

PDB Description: high affinity ige receptor (alpha chain) complexed with tight-binding e131 'zeta' peptide from phage display

PDB Compounds: (D:) High affinity immunoglobulin epsilon receptor alpha-subunit precursor

SCOPe Domain Sequences for d1rpqd1:

Sequence, based on SEQRES records:

>d1rpqd1 b.1.1.4 (D:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakfeds
geykcqhqqvnesepvylevfs

Sequence, based on observed residues (ATOM records):

>d1rpqd1 b.1.1.4 (D:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
kpkvslnppwnrifkgenvtltcngnnffvsstkwfhngslseetnsslnivnakfedsg
eykcqhqqvnesepvylevfs

Timeline for d1rpqd1:

• d1rpqd1 first appeared in SCOP 1.69
  
• d1rpqd1 appears in SCOPe 2.05
  
• d1rpqd1 appears in SCOPe 2.07
  
• d1rpqd1 appears in the current release, SCOPe 2.08