SCOP 1.75: Domain d1rnja_: 1rnj A:

Lineage for d1rnja_ (1rnj A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
   Uniprot P06968

8. Domain d1rnja_: 1rnj A: [105021]
   complexed with dup, mg, trs; mutant

Details for d1rnja_

PDB Entry: 1rnj, 1.7 Å

PDB Description: crystal structure of inactive mutant dutpase complexed with substrate analogue imido-dutp

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d1rnja_:

Sequence, based on SEQRES records:

>d1rnja_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfdatdrgeggfghsgrq

Sequence, based on observed residues (ATOM records):

>d1rnja_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
dpslaammlprsglghkhgivlgnlvglinsdyqgqlmisvwnrgqdsftiqpgeriaqm
ifvpvvqaefnlvedfrfrq

Timeline for d1rnja_:

• d1rnja_ first appeared in SCOP 1.69
  
• d1rnja_ appears in SCOP 1.73
  
• d1rnja_ appears in SCOPe 2.01
  
• d1rnja_ appears in the current release, SCOPe 2.08