SCOPe 2.04: Domain d1rm4b1: 1rm4 B:1-148,B:313-333

Lineage for d1rm4b1 (1rm4 B:1-148,B:313-333)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
   Uniprot P19866

8. Domain d1rm4b1: 1rm4 B:1-148,B:313-333 [105002]
   Other proteins in same PDB: d1rm4a2, d1rm4b2, d1rm4o2
   complexed with ndp, so4

Details for d1rm4b1

PDB Entry: 1rm4, 2 Å

PDB Description: Crystal structure of recombinant photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform, complexed with NADP

PDB Compounds: (B:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOPe Domain Sequences for d1rm4b1:

Sequence; same for both SEQRES and ATOM records:

>d1rm4b1 c.2.1.3 (B:1-148,B:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
lkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvkt
agdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvli
tapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

Timeline for d1rm4b1:

• d1rm4b1 first appeared in SCOP 1.69
  
• d1rm4b1 appears in SCOPe 2.03
  
• d1rm4b1 appears in SCOPe 2.05
  
• d1rm4b1 appears in the current release, SCOPe 2.08