Lineage for d1rm3o1 (1rm3 O:1-148,O:313-333)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 477908Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 478030Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (5 PDB entries)
  8. 478039Domain d1rm3o1: 1rm3 O:1-148,O:313-333 [104998]
    Other proteins in same PDB: d1rm3a2, d1rm3b2, d1rm3o2

Details for d1rm3o1

PDB Entry: 1rm3 (more details), 2.2 Å

PDB Description: crystal structure of mutant t33a of photosynthetic glyceraldehyde-3- phosphate dehydrogenase a4 isoform, complexed with nadp

SCOP Domain Sequences for d1rm3o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm3o1 c.2.1.3 (O:1-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
lkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvkt
agdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvli
tapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

SCOP Domain Coordinates for d1rm3o1:

Click to download the PDB-style file with coordinates for d1rm3o1.
(The format of our PDB-style files is described here.)

Timeline for d1rm3o1: