SCOP 1.73: Domain d1rm3b2: 1rm3 B:149-312

Lineage for d1rm3b2 (1rm3 B:149-312)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (8 PDB entries)

8. Domain d1rm3b2: 1rm3 B:149-312 [104997]
   Other proteins in same PDB: d1rm3a1, d1rm3b1, d1rm3o1

Details for d1rm3b2

PDB Entry: 1rm3, 2.2 Å

PDB Description: crystal structure of mutant t33a of photosynthetic glyceraldehyde-3- phosphate dehydrogenase a4 isoform, complexed with nadp

PDB Compounds: (B:) Glyceraldehyde 3-phosphate dehydrogenase A

SCOP Domain Sequences for d1rm3b2:

Sequence; same for both SEQRES and ATOM records:

>d1rm3b2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

Timeline for d1rm3b2:

• d1rm3b2 first appeared in SCOP 1.69
  
• d1rm3b2 appears in SCOP 1.71
  
• d1rm3b2 appears in SCOP 1.75
  
• d1rm3b2 appears in the current release, SCOPe 2.08