Lineage for d1rm0b2 (1rm0 B:323-437)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962012Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2962094Protein Myo-inositol 1-phosphate synthase [75484] (4 species)
  7. 2962102Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
    Uniprot P11986
  8. 2962106Domain d1rm0b2: 1rm0 B:323-437 [104993]
    Other proteins in same PDB: d1rm0a1, d1rm0b1
    complexed with d6p, mn, nai

Details for d1rm0b2

PDB Entry: 1rm0 (more details), 2.05 Å

PDB Description: Crystal Structure of Myo-Inositol 1-Phosphate Synthase From Saccharomyces cerevisiae In Complex With NAD+ and 2-deoxy-D-glucitol 6-(E)-vinylhomophosphonate
PDB Compounds: (B:) myo-inositol-phosphate synthase

SCOPe Domain Sequences for d1rm0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm0b2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

SCOPe Domain Coordinates for d1rm0b2:

Click to download the PDB-style file with coordinates for d1rm0b2.
(The format of our PDB-style files is described here.)

Timeline for d1rm0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rm0b1