SCOP 1.75: Domain d1rlgb_: 1rlg B:

Lineage for d1rlgb_ (1rlg B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [111034] (1 PDB entry)
   Uniprot O29494 # AF0764

8. Domain d1rlgb_: 1rlg B: [104982]
   complexed with 5bu

Details for d1rlgb_

PDB Entry: 1rlg, 2.7 Å

PDB Description: molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex

PDB Compounds: (B:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1rlgb_:

Sequence; same for both SEQRES and ATOM records:

>d1rlgb_ d.79.3.1 (B:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
yvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeivah
lpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglq

Timeline for d1rlgb_:

• d1rlgb_ first appeared in SCOP 1.69
  
• d1rlgb_ appears in SCOP 1.73
  
• d1rlgb_ appears in SCOPe 2.01
  
• d1rlgb_ appears in the current release, SCOPe 2.08