Lineage for d1rjva_ (1rjv A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768641Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 768647Protein Parvalbumin [47495] (8 species)
  7. 768657Species Human (Homo sapiens) [TaxId:9606] [109818] (2 PDB entries)
    Uniprot P20472
  8. 768658Domain d1rjva_: 1rjv A: [104964]
    complexed with ca

Details for d1rjva_

PDB Entry: 1rjv (more details)

PDB Description: solution structure of human alpha-parvalbumin refined with a paramagnetism-based strategy
PDB Compounds: (A:) parvalbumin alpha

SCOP Domain Sequences for d1rjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjva_ a.39.1.4 (A:) Parvalbumin {Human (Homo sapiens) [TaxId: 9606]}
msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfie
edelgfilkgfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes

SCOP Domain Coordinates for d1rjva_:

Click to download the PDB-style file with coordinates for d1rjva_.
(The format of our PDB-style files is described here.)

Timeline for d1rjva_: