Lineage for d1rj2a1 (1rj2 A:624-818)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540906Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 540907Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 540908Family a.87.1.1: DBL homology domain (DH-domain) [48066] (9 proteins)
    Pfam 00621
  6. 540912Protein Dbl's big sister, Dbs [74743] (1 species)
  7. 540913Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
  8. 540922Domain d1rj2a1: 1rj2 A:624-818 [104954]
    Other proteins in same PDB: d1rj2a2, d1rj2d2, d1rj2g2, d1rj2j2

Details for d1rj2a1

PDB Entry: 1rj2 (more details), 3 Å

PDB Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase

SCOP Domain Sequences for d1rj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj2a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus)}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOP Domain Coordinates for d1rj2a1:

Click to download the PDB-style file with coordinates for d1rj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1rj2a1: