SCOP 1.73: Domain d1re4e2: 1re4 E:166-199

Lineage for d1re4e2 (1re4 E:166-199)

1. Root: SCOP 1.73

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen beta chain [88892] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)

8. Domain d1re4e2: 1re4 E:166-199 [104908]
   Other proteins in same PDB: d1re4a_, d1re4b1, d1re4c1, d1re4c2, d1re4d_, d1re4e1, d1re4f1, d1re4f2
   complexed with ca, nag; mutant

Details for d1re4e2

PDB Entry: 1re4, 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen

PDB Compounds: (E:) fibrinogen beta chain

SCOP Domain Sequences for d1re4e2:

Sequence; same for both SEQRES and ATOM records:

>d1re4e2 h.1.8.1 (E:166-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
rvlrsilenlrskiqklesdvsaqmeycrtpctv

Timeline for d1re4e2:

• d1re4e2 first appeared in SCOP 1.69
  
• d1re4e2 appears in SCOP 1.71
  
• d1re4e2 appears in SCOP 1.75
  
• d1re4e2 appears in the current release, SCOPe 2.08