Lineage for d1re3e2 (1re3 E:165-199)

  1. Root: SCOP 1.71
  2. 625746Class h: Coiled coil proteins [57942] (7 folds)
  3. 625747Fold h.1: Parallel coiled-coil [57943] (29 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 626217Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 626218Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 626266Protein Fibrinogen beta chain [88892] (4 species)
  7. 626275Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
  8. 626279Domain d1re3e2: 1re3 E:165-199 [104898]
    Other proteins in same PDB: d1re3a_, d1re3b1, d1re3c1, d1re3c2, d1re3d_, d1re3e1, d1re3f1, d1re3f2
    complexed with ca, nag; mutant

Details for d1re3e2

PDB Entry: 1re3 (more details), 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide

SCOP Domain Sequences for d1re3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re3e2 h.1.8.1 (E:165-199) Fibrinogen beta chain {Human (Homo sapiens)}
lrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1re3e2:

Click to download the PDB-style file with coordinates for d1re3e2.
(The format of our PDB-style files is described here.)

Timeline for d1re3e2: