Lineage for d1re3c1 (1re3 C:142-393)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560122Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 2560132Domain d1re3c1: 1re3 C:142-393 [104894]
    Other proteins in same PDB: d1re3a_, d1re3b2, d1re3c2, d1re3d_, d1re3e2, d1re3f2
    complexed with ca

Details for d1re3c1

PDB Entry: 1re3 (more details), 2.45 Å

PDB Description: Crystal Structure of Fragment D of BbetaD398A Fibrinogen with the Peptide Ligand Gly-His-Arg-Pro-Amide
PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1re3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re3c1 d.171.1.1 (C:142-393) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlt

SCOPe Domain Coordinates for d1re3c1:

Click to download the PDB-style file with coordinates for d1re3c1.
(The format of our PDB-style files is described here.)

Timeline for d1re3c1: