SCOP 1.75: Domain d1re3b1: 1re3 B:200-458

Lineage for d1re3b1 (1re3 B:200-458)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
unusual fold
Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family)
Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
Protein Fibrinogen C-terminal domains [56498] (7 species)
Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
Uniprot P02675
Domain d1re3b1: 1re3 B:200-458 [104892]
Other proteins in same PDB: d1re3a_, d1re3b2, d1re3c2, d1re3d_, d1re3e2, d1re3f2

Details for d1re3b1

PDB Entry: 1re3 (more details), 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (B:) fibrinogen beta chain

SCOP Domain Sequences for d1re3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re3b1 d.171.1.1 (B:200-458) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpff

SCOP Domain Coordinates for d1re3b1:

Click to download the PDB-style file with coordinates for d1re3b1.
(The format of our PDB-style files is described here.)

Timeline for d1re3b1: