SCOPe 2.01: Domain d1rdua_: 1rdu A:

Lineage for d1rdua_ (1rdu A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.5: Nitrogenase accessory factor-like [53146] (3 families)

5. Family c.55.5.1: MTH1175-like [53147] (3 proteins)

6. Protein Hypothetical protein TM1290 [110643] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110644] (1 PDB entry)
   Uniprot Q9X116

8. Domain d1rdua_: 1rdu A: [104890]
   Structural genomics target

Details for d1rdua_

PDB Entry: 1rdu

PDB Description: nmr structure of a putative nifb protein from thermotoga (tm1290), which belongs to the duf35 family

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1rdua_:

Sequence; same for both SEQRES and ATOM records:

>d1rdua_ c.55.5.1 (A:) Hypothetical protein TM1290 {Thermotoga maritima [TaxId: 2336]}
marvaipsvgkdlssmvsdrfaraeyfiiydtesgnvevventiadahgtgpkvvqslvs
kgveyliasnvgrnafetlkaagvkvyrfeggtvqeaidafsegrleelttftreg

Timeline for d1rdua_:

• d1rdua_ first appeared in SCOP 1.69
  
• d1rdua_ appears in SCOP 1.75
  
• d1rdua_ appears in SCOPe 2.02
  
• d1rdua_ appears in the current release, SCOPe 2.08