| Class b: All beta proteins [48724] (178 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) ![]() the barrel is decorated with additional structures |
| Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins) |
| Protein Alanine racemase [50623] (3 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [110243] (1 PDB entry) Uniprot Q9HTQ2 |
| Domain d1rcqa1: 1rcq A:1-7,A:234-357 [104882] Other proteins in same PDB: d1rcqa2 complexed with dly, plp |
PDB Entry: 1rcq (more details), 1.45 Å
SCOPe Domain Sequences for d1rcqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcqa1 b.49.2.2 (A:1-7,A:234-357) Alanine racemase {Pseudomonas aeruginosa [TaxId: 287]}
mrparalXtleskvisvrdlpagepvgygarysterrqrigvvamgyadgyprhaadgtl
vfidgkpgrlvgrvsmdmltvdltdhpqaglgsrvelwgpnvpvgalaaqfgsipyqllc
nlkrvprvysga
Timeline for d1rcqa1: