Lineage for d1rcqa1 (1rcq A:1-7,A:234-357)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466323Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 466416Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 466417Family b.49.2.2: Alanine racemase [88682] (1 protein)
  6. 466418Protein Alanine racemase [50623] (3 species)
  7. 466436Species Pseudomonas aeruginosa [TaxId:287] [110243] (1 PDB entry)
  8. 466437Domain d1rcqa1: 1rcq A:1-7,A:234-357 [104882]
    Other proteins in same PDB: d1rcqa2

Details for d1rcqa1

PDB Entry: 1rcq (more details), 1.45 Å

PDB Description: The 1.45 A crystal structure of alanine racemase from a pathogenic bacterium, Pseudomonas aeruginosa, contains both internal and external aldimine forms

SCOP Domain Sequences for d1rcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcqa1 b.49.2.2 (A:1-7,A:234-357) Alanine racemase {Pseudomonas aeruginosa}
mrparalXtleskvisvrdlpagepvgygarysterrqrigvvamgyadgyprhaadgtl
vfidgkpgrlvgrvsmdmltvdltdhpqaglgsrvelwgpnvpvgalaaqfgsipyqllc
nlkrvprvysga

SCOP Domain Coordinates for d1rcqa1:

Click to download the PDB-style file with coordinates for d1rcqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rcqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rcqa2