Lineage for d1r8jb2 (1r8j B:1-135)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356386Family c.23.1.5: N-terminal domain of the circadian clock protein KaiA [82344] (1 protein)
    lacks canonical receiver domains features
  6. 1356387Protein N-terminal domain of the circadian clock protein KaiA [82345] (1 species)
  7. 1356388Species Synechococcus elongatus [TaxId:32046] [82346] (3 PDB entries)
    Uniprot Q79PF6
  8. 1356390Domain d1r8jb2: 1r8j B:1-135 [104850]
    Other proteins in same PDB: d1r8ja1, d1r8jb1
    structured linker 136-176 in swapped dimer

Details for d1r8jb2

PDB Entry: 1r8j (more details), 2.03 Å

PDB Description: Crystal Structure of Circadian Clock Protein KaiA from Synechococcus elongatus
PDB Compounds: (B:) KaiA

SCOPe Domain Sequences for d1r8jb2:

Sequence, based on SEQRES records: (download)

>d1r8jb2 c.23.1.5 (B:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]}
vlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
psfravvqqlcfegvvvpaivvgdrdsedpdepakeqlyhsaelhlgihqleqlpyqvda
alaeflrlapvetma

Sequence, based on observed residues (ATOM records): (download)

>d1r8jb2 c.23.1.5 (B:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]}
vlsqiaiciwvestailqdcqralsadryqlqvcesgemlleyaqthrdqidclilvaan
psfravvqqlcfegvvvpaivvgdpakeqlyhsaelhlgihqleqlpyqvdaalaeflrl
apvetma

SCOPe Domain Coordinates for d1r8jb2:

Click to download the PDB-style file with coordinates for d1r8jb2.
(The format of our PDB-style files is described here.)

Timeline for d1r8jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r8jb1