Lineage for d1r8gb_ (1r8g B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510750Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 510751Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (3 families) (S)
  5. 510897Family d.128.1.3: Glutamate-cysteine ligase family 2(GCS2, Pfam 04107) [111160] (1 protein)
    structural and functional relationships to Glutamine synthetase
  6. 510898Protein Carboxylate-amine ligase YbdK [111161] (2 species)
  7. 510899Species Escherichia coli [TaxId:562] [111162] (1 PDB entry)
  8. 510901Domain d1r8gb_: 1r8g B: [104846]
    Structural genomics target

Details for d1r8gb_

PDB Entry: 1r8g (more details), 2.15 Å

PDB Description: structure and function of ybdk

SCOP Domain Sequences for d1r8gb_:

Sequence, based on SEQRES records: (download)

>d1r8gb_ d.128.1.3 (B:) Carboxylate-amine ligase YbdK {Escherichia coli}
plpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhditesmlel
atdvcrdinqaagqfsamqkvvlqaatdhhleicgggthpfqkwqrqevcdneryqrtle
nfgyliqqatvfgqhvhvgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfass
rpnifsafpdngpmpwvsnwqqfealfrclsyttmidsikdlhwdirpsphfgtvevrvm
dtpltlshavnmagliqatahwllterpfkhqekdyllykfnrfqacryglegvitdpht
gdrrpltedtlrllekiapsahkigassaiealhrqvvsglneaqlmrdfvadggsligl
vkkhceiwa

Sequence, based on observed residues (ATOM records): (download)

>d1r8gb_ d.128.1.3 (B:) Carboxylate-amine ligase YbdK {Escherichia coli}
plpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhitesmlela
tdvcrdinqaagqfsamqkvvlqaatdhhleicgggthpfqkwqqrtlenfgyliqqatv
fgqhvhvgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfassrpnifsafpdn
gpmpwvsnwqqfealfrclsyttmidsikdlhwdirpsphfgtvevrvmdtpltlshavn
magliqatahwllterpfkhqekdyllykfnrfqacryglegvitdphtgdrrpltedtl
rllekiapsahkigassaiealhrqvvsglneaqlmrdfvadggsliglvkkhceiwa

SCOP Domain Coordinates for d1r8gb_:

Click to download the PDB-style file with coordinates for d1r8gb_.
(The format of our PDB-style files is described here.)

Timeline for d1r8gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r8ga_