Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species) duplication: two AAA+ modules; the first module is structurally similar to the CDC6 module whereas the second module to the HslU module |
Species Escherichia coli [TaxId:562] [82422] (2 PDB entries) Uniprot Q83LR6 |
Domain d1r6bx3: 1r6b X:437-751 [104820] Other proteins in same PDB: d1r6bx1 complexed with adp, mg; mutant |
PDB Entry: 1r6b (more details), 2.25 Å
SCOP Domain Sequences for d1r6bx3:
Sequence, based on SEQRES records: (download)
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvreterks iglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqk gvslevsqearnwlaekgydramgarpmarviqdnlkkplanellfgslvdggqvtvald kekneltygfqsaqk
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvrameeik kiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqkgvslevsqearnwlaek gydramgarpmarviqdnlkkplanellfgslvdggqvtvaldkekneltygfqsaqk
Timeline for d1r6bx3: