Lineage for d1r6bx2 (1r6b X:169-436)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990157Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 990210Protein ClpA, an Hsp100 chaperone, AAA+ modules [82421] (1 species)
    duplication: two AAA+ modules; the first module is structurally similar to the CDC6 module whereas the second module to the HslU module
  7. 990211Species Escherichia coli [TaxId:562] [82422] (2 PDB entries)
    Uniprot Q83LR6
  8. 990212Domain d1r6bx2: 1r6b X:169-436 [104819]
    Other proteins in same PDB: d1r6bx1
    complexed with adp, mg

Details for d1r6bx2

PDB Entry: 1r6b (more details), 2.25 Å

PDB Description: high resolution crystal structure of clpa
PDB Compounds: (X:) ClpA protein

SCOPe Domain Sequences for d1r6bx2:

Sequence, based on SEQRES records: (download)

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
lenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegla
wrivqgdvpevmadctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfideih
tiigagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkidite
psieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagar
arlmpvskrkktvnvadiesvvariari

Sequence, based on observed residues (ATOM records): (download)

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}
lenfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegla
wrivqgdvpevmadctiysldigagtkyrgdfekrfkallkqleqdtnsilfideihtii
gagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkiditepsi
eetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagararl
mpvskrkktvnvadiesvvariari

SCOPe Domain Coordinates for d1r6bx2:

Click to download the PDB-style file with coordinates for d1r6bx2.
(The format of our PDB-style files is described here.)

Timeline for d1r6bx2: