Lineage for d1r5oa2 (1r5o A:555-622)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464915Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 464916Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)
  6. 464961Protein Eukaryotic peptide chain release factor ERF2, C-terminal domain [110229] (1 species)
  7. 464962Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110230] (3 PDB entries)
  8. 464965Domain d1r5oa2: 1r5o A:555-622 [104810]
    Other proteins in same PDB: d1r5oa1, d1r5oa3

Details for d1r5oa2

PDB Entry: 1r5o (more details), 3.2 Å

PDB Description: crystal structure analysis of sup35 complexed with GMPPNP

SCOP Domain Sequences for d1r5oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5oa2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe)}
hattrfiaqiailelpsilttgyscvmhihtaveevsfakllhkldktnrkskkppmfat
kgmkiiae

SCOP Domain Coordinates for d1r5oa2:

Click to download the PDB-style file with coordinates for d1r5oa2.
(The format of our PDB-style files is described here.)

Timeline for d1r5oa2: