Lineage for d1r5oa1 (1r5o A:460-554)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464647Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 464648Family b.43.3.1: Elongation factors [50448] (8 proteins)
  6. 464708Protein Eukaryotic peptide chain release factor ERF2, post-G domain [110225] (1 species)
  7. 464709Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110226] (3 PDB entries)
  8. 464712Domain d1r5oa1: 1r5o A:460-554 [104809]
    Other proteins in same PDB: d1r5oa2, d1r5oa3

Details for d1r5oa1

PDB Entry: 1r5o (more details), 3.2 Å

PDB Description: crystal structure analysis of sup35 complexed with GMPPNP

SCOP Domain Sequences for d1r5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5oa1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe)}
hlerkvnapfimpiaskykdlgtilegkieagsikknsnvlvmpinqtlevtaiydeade
eisssicgdqvrlrvrgddsdvqtgyvltstknpv

SCOP Domain Coordinates for d1r5oa1:

Click to download the PDB-style file with coordinates for d1r5oa1.
(The format of our PDB-style files is described here.)

Timeline for d1r5oa1: