Lineage for d1r5na1 (1r5n A:460-554)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669500Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 669616Protein Eukaryotic peptide chain release factor ERF2, post-G domain [110225] (1 species)
  7. 669617Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [110226] (3 PDB entries)
  8. 669619Domain d1r5na1: 1r5n A:460-554 [104806]
    Other proteins in same PDB: d1r5na2, d1r5na3
    complexed with gdp

Details for d1r5na1

PDB Entry: 1r5n (more details), 2.9 Å

PDB Description: Crystal Structure Analysis of sup35 complexed with GDP
PDB Compounds: (A:) Eukaryotic peptide chain release factor GTP-binding subunit

SCOP Domain Sequences for d1r5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5na1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
hlerkvnapfimpiaskykdlgtilegkieagsikknsnvlvmpinqtlevtaiydeade
eisssicgdqvrlrvrgddsdvqtgyvltstknpv

SCOP Domain Coordinates for d1r5na1:

Click to download the PDB-style file with coordinates for d1r5na1.
(The format of our PDB-style files is described here.)

Timeline for d1r5na1: