Lineage for d1r2va2 (1r2v A:240-307)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 502014Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 502015Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 502120Protein Signal processing protein (SPC-40, MGP-40) [89882] (4 species)
    secreted during involution
  7. 502129Species Sheep (Ovis aries) # [109621] (3 PDB entries)
  8. 502130Domain d1r2va2: 1r2v A:240-307 [104785]
    Other proteins in same PDB: d1r2va1

Details for d1r2va2

PDB Entry: 1r2v (more details), 2.07 Å

PDB Description: Crystal structure of a secretory 40kDa glycoprotein from sheep mammary gland at 2.0A resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d1r2va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2va2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) #}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOP Domain Coordinates for d1r2va2:

Click to download the PDB-style file with coordinates for d1r2va2.
(The format of our PDB-style files is described here.)

Timeline for d1r2va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r2va1