SCOP 1.73: Domain d1r1va_: 1r1v A:

Lineage for d1r1va_ (1r1v A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (4 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [109665] (2 PDB entries)

8. Domain d1r1va_: 1r1v A: [104775]

Details for d1r1va_

PDB Entry: 1r1v, 2.3 Å

PDB Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the Zn2-form

PDB Compounds: (A:) repressor protein

SCOP Domain Sequences for d1r1va_:

Sequence; same for both SEQRES and ATOM records:

>d1r1va_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhpke

Timeline for d1r1va_:

• d1r1va_ first appeared in SCOP 1.69
  
• d1r1va_ appears in SCOP 1.71
  
• d1r1va_ appears in SCOP 1.75
  
• d1r1va_ appears in the current release, SCOPe 2.08