SCOPe 2.06: Domain d1r1sc_: 1r1s C:

Lineage for d1r1sc_ (1r1s C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)
   Uniprot O89100 53-147

8. Domain d1r1sc_: 1r1s C: [104766]
   Other proteins in same PDB: d1r1se2, d1r1sg2
   complexed with so4

Details for d1r1sc_

PDB Entry: 1r1s, 1.9 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads

PDB Compounds: (C:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d1r1sc_:

Sequence; same for both SEQRES and ATOM records:

>d1r1sc_ d.93.1.1 (C:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]}
diefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdt
kgnyflwtekfpslnklvdyyrttsiskqkqvflrd

Timeline for d1r1sc_:

• d1r1sc_ first appeared in SCOP 1.69
  
• d1r1sc_ appears in SCOPe 2.05
  
• d1r1sc_ appears in SCOPe 2.07
  
• d1r1sc_ appears in the current release, SCOPe 2.08