Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries) Uniprot O89100 53-147 |
Domain d1r1sc_: 1r1s C: [104766] Other proteins in same PDB: d1r1se2, d1r1sg2 complexed with so4 |
PDB Entry: 1r1s (more details), 1.9 Å
SCOPe Domain Sequences for d1r1sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1sc_ d.93.1.1 (C:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} diefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdt kgnyflwtekfpslnklvdyyrttsiskqkqvflrd
Timeline for d1r1sc_: