Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (31 proteins) Pfam 00017 |
Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries) |
Domain d1r1qb_: 1r1q B: [104764] complexed with ace, so4 |
PDB Entry: 1r1q (more details), 1.8 Å
SCOP Domain Sequences for d1r1qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1qb_ d.93.1.1 (B:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus)} gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd
Timeline for d1r1qb_: