Lineage for d1r1pc1 (1r1p C:52-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965371Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)
  7. 2965372Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)
    Uniprot O89100 53-147
  8. 2965377Domain d1r1pc1: 1r1p C:52-149 [104761]
    Other proteins in same PDB: d1r1pb2, d1r1pc2
    complexed with so4

Details for d1r1pc1

PDB Entry: 1r1p (more details), 1.8 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads
PDB Compounds: (C:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d1r1pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1pc1 d.93.1.1 (C:52-149) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]}
fidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmr
dtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

SCOPe Domain Coordinates for d1r1pc1:

Click to download the PDB-style file with coordinates for d1r1pc1.
(The format of our PDB-style files is described here.)

Timeline for d1r1pc1: