Lineage for d1r0bl2 (1r0b L:101-153)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036845Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 3036846Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 3036847Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 3036848Species Escherichia coli [TaxId:562] [57828] (62 PDB entries)
    Uniprot P00478
  8. 3036981Domain d1r0bl2: 1r0b L:101-153 [104706]
    Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg1, d1r0bh1, d1r0bi1, d1r0bj1, d1r0bk1, d1r0bl1
    complexed with flc, po4, zn

Details for d1r0bl2

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate
PDB Compounds: (L:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1r0bl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bl2 g.41.7.1 (L:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1r0bl2:

Click to download the PDB-style file with coordinates for d1r0bl2.
(The format of our PDB-style files is described here.)

Timeline for d1r0bl2: